Loading...
Statistics
Advertisement

Industrial Ventilation Fan / Blower
www.olegsystems.com/
Industrial process air exhaust and supply ventilation systems, air moving and gas trasfer blower fans, air knives and air curtains, dust collectors, wet ...

Olegsystems.com

Advertisement
Conversion Technology Metas Server
Olegsystems.com is hosted in United States / Dallas . Olegsystems.com doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache/1.3.41 (Unix) mod_layout/3.4 DAV/1.0.3 FrontPage/5.0.2.2635.

Technologies in use by Olegsystems.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache/1.3.41 (Unix) mod_layout/3.4 DAV/1.0.3 FrontPage/5.0.2.2635

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Olegsystems.com

Missing HTTPS protocol.

    Meta - Olegsystems.com

    Number of occurences: 6
    • Name:
      Content: text/html; charset=iso-8859-1
    • Name: GENERATOR
      Content: Mozilla/4.79 [en]C-PCFr2WIN (Windows NT 5.0; U) [Netscape]
    • Name: KeyWords
      Content: T.905-336-7122. Industrial Ventilation System,Industrial Air System,Air Exhaust,Air Supply,Air Exhaust System,Fan,Blower,Ventilator,Air Fans,Air Blowers,Air Ventilators,Industrial Fan,Pressure Blower,Industrial Blower,Industrial Air-Knife,Air Knives,Air-Canon,Air Canons,High Temperature Fans,High Pressure Blowers,Gas Blower,Gas Fans,Ventilation,Ventilating,Industrial,Air Moving,Dust Collection,Dust Collector,Dust Collecting,Fume Collector,Fume Collection,Scrubber,Industrial Vacuum,Pneumatic Blower,Pneumatic Conveying,Exhaust System,Air Transfer,Industrial Ventilation Systems,Industrial Ventilation,Ventilation System,Ventilation Systems
    • Name: description
      Content: Industrial process air exhaust and supply ventilation systems, air moving and gas trasfer blower fans, air knives and air curtains, dust collectors, wet scrubbers, fume collector ventilators sales. Sales of industrial process and OEM fans, turbo pressure blowers and high volume ventilators.
    • Name: Template
      Content: C:\PROGRAM FILES\MICROSOFT OFFICE\OFFICE\html.dot
    • Name: Author
      Content: NISCO

    Server / Hosting

    • IP: 67.228.0.96
    • Latitude: 32.78
    • Longitude: -96.82
    • Country: United States
    • City: Dallas

    Rname

    • ns16.seanic.net
    • ns15.seanic.net
    • backup19.seanic.net
    • mx1.seanic.net

    Target

    • hostmaster.seanic.net

    HTTP Header Response

    HTTP/1.1 200 OK Date: Wed, 03 Aug 2016 16:23:20 GMT Server: Apache/1.3.41 (Unix) mod_layout/3.4 DAV/1.0.3 FrontPage/5.0.2.2635 Last-Modified: Mon, 25 Apr 2016 19:52:33 GMT ETag: "c82b53-3bc0-571e7581" Accept-Ranges: bytes Content-Length: 15296 Content-Type: text/html X-Cache: MISS from s_hp65 X-Cache-Lookup: MISS from s_hp65:80 Via: 1.1 s_hp65 (squid/3.5.19) Connection: keep-alive

    DNS

    host: olegsystems.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 67.228.0.96
    host: olegsystems.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns16.seanic.net
    host: olegsystems.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns15.seanic.net
    host: olegsystems.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns15.seanic.net
    5. rname: hostmaster.seanic.net
    6. serial: 1999033001
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 86400
    host: olegsystems.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: backup19.seanic.net
    host: olegsystems.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 5
    5. target: mx1.seanic.net

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.legsystems.com, www.oblegsystems.com, www.blegsystems.com, www.ohlegsystems.com, www.hlegsystems.com, www.oglegsystems.com, www.glegsystems.com, www.ojlegsystems.com, www.jlegsystems.com, www.omlegsystems.com, www.mlegsystems.com, www.o legsystems.com, www. legsystems.com, www.ovlegsystems.com, www.vlegsystems.com, www.oegsystems.com, www.oluegsystems.com, www.ouegsystems.com, www.ol8egsystems.com, www.o8egsystems.com, www.ol9egsystems.com, www.o9egsystems.com, www.oljegsystems.com, www.ojegsystems.com, www.ol0egsystems.com, www.o0egsystems.com, www.olmegsystems.com, www.omegsystems.com, www.olpegsystems.com, www.opegsystems.com, www.oloegsystems.com, www.ooegsystems.com, www.olgsystems.com, www.olexgsystems.com, www.olxgsystems.com, www.olesgsystems.com, www.olsgsystems.com, www.olewgsystems.com, www.olwgsystems.com, www.olergsystems.com, www.olrgsystems.com, www.olefgsystems.com, www.olfgsystems.com, www.olevgsystems.com, www.olvgsystems.com, www.olecgsystems.com, www.olcgsystems.com, www.oleqgsystems.com, www.olqgsystems.com, www.oleagsystems.com, www.olagsystems.com, www.oleygsystems.com, www.olygsystems.com, www.olesystems.com, www.olegssystems.com, www.olessystems.com, www.olegxsystems.com, www.olexsystems.com, www.olegysystems.com, www.oleysystems.com, www.oleghsystems.com, www.olehsystems.com, www.olegnsystems.com, www.olensystems.com, www.olegcsystems.com, www.olecsystems.com, www.olegdsystems.com, www.oledsystems.com, www.olegesystems.com, www.oleesystems.com, www.olegrsystems.com, www.olersystems.com, www.olegtsystems.com, www.oletsystems.com, www.olegbsystems.com, www.olebsystems.com, www.olegvsystems.com, www.olevsystems.com, www.olegystems.com, www.olegseystems.com, www.olegeystems.com, www.olegswystems.com, www.olegwystems.com, www.olegsdystems.com, www.olegdystems.com, www.olegsxystems.com, www.olegxystems.com, www.olegsfystems.com, www.olegfystems.com, www.olegsgystems.com, www.oleggystems.com, www.olegstystems.com, www.olegtystems.com, www.olegsstems.com, www.olegsyzstems.com, www.olegszstems.com, www.olegsyastems.com, www.olegsastems.com, www.olegsysstems.com, www.olegssstems.com, www.olegsydstems.com, www.olegsdstems.com, www.olegsystems.com, www.olegsstems.com, www.olegsycstems.com, www.olegscstems.com, www.olegsy stems.com, www.olegs stems.com, www.olegsytems.com, www.olegsysetems.com, www.olegsyetems.com, www.olegsyswtems.com, www.olegsywtems.com, www.olegsysdtems.com, www.olegsydtems.com, www.olegsysxtems.com, www.olegsyxtems.com, www.olegsysftems.com, www.olegsyftems.com, www.olegsysgtems.com, www.olegsygtems.com, www.olegsysttems.com, www.olegsyttems.com, www.olegsysems.com, www.olegsystqems.com, www.olegsysqems.com, www.olegsystaems.com, www.olegsysaems.com, www.olegsyst ems.com, www.olegsys ems.com, www.olegsystwems.com, www.olegsyswems.com, www.olegsysteems.com, www.olegsyseems.com, www.olegsystzems.com, www.olegsyszems.com, www.olegsystxems.com, www.olegsysxems.com, www.olegsystcems.com, www.olegsyscems.com, www.olegsystms.com, www.olegsystexms.com, www.olegsystxms.com, www.olegsystesms.com, www.olegsystsms.com, www.olegsystewms.com, www.olegsystwms.com, www.olegsysterms.com, www.olegsystrms.com, www.olegsystefms.com, www.olegsystfms.com, www.olegsystevms.com, www.olegsystvms.com, www.olegsystecms.com, www.olegsystcms.com, www.olegsysteqms.com, www.olegsystqms.com, www.olegsysteams.com, www.olegsystams.com, www.olegsysteyms.com, www.olegsystyms.com,

    Other websites we recently analyzed

    1. paardekooper.info
      Metairie (United States) - 199.7.108.176
      Server software: Apache/2.2.29 (Unix) mod_ssl/2.2.29 OpenSSL/1.0.1e-fips DAV/2 mod_bwlimited/1.4 mod_perl/2.0.8 Perl/v5.10.1
      Technology: Html
      Number of meta tags: 1
    2. JIN arrangerar - Hem
      San Francisco (United States) - 199.34.228.53
      Server software: Microsoft-IIS/8.5
      Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
      Number of Javascript: 6
      Number of meta tags: 1
    3. Представительство — Общественная приемная Комитета Государственной Думы РФ по обороне в Северо-Западном Федеральном округе РФ
      Russian Federation - 77.222.61.78
      Server software: nginx/1.9.12
      Technology: CSS, Html, Html5, Javascript, jQuery, Yandex.Metrika, Wordpress
      Number of Javascript: 9
      Number of meta tags: 2
    4. breezeivr.net
      Scottsdale (United States) - 50.63.202.1
      Server software: Microsoft-IIS/7.5
      Technology: Html
    5. Anura Yapa | The Noble Man of our Mind
      Houston (United States) - 192.185.98.195
      G Analytics ID: UA-65967410-1
      Server software: nginx/1.10.0
      Technology: BootstrapCDN, Maxcdn, OSS CDN, AJAX Libraries API, Carousel, CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Lightbox, Php, Pingback, Google Analytics, Wordpress, Facebook Box, Twitter Button
      Number of Javascript: 18
      Number of meta tags: 3
    6. alpsankhyakpiccharavargkalyansamiti.org
      Austin (United States) - 209.99.40.219
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    7. profoshow.com
      Road Town (Virgin Islands, British) - 208.91.197.218
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    8. Goldrausch Friseure in Wiesbaden - Home
      Wir, die Goldrausch-Friseure kümmern uns um Ihre menschliche Sehnsucht nach Schönheit. Teamgeist, Mut und Stolz für die Aufgabe sowie Freude an der täglichen Arbeit führen uns virtuos mit Auge, Gefühl und Hand zur Gestaltung typgerechter Frisurenwelten.
      Germany - 89.31.143.122
      Server software: UD Webspace 3.0
      Technology: CSS, Html, Javascript, Google Analytics, Share This Social Media Buttons
      Number of Javascript: 9
      Number of meta tags: 8
    9. Home - Apartamento En GazcueApartamento En Gazcue
      Scottsdale (United States) - 23.229.238.193
      G Analytics ID: UA-39150543-11
      Server software: Apache/2.4.12
      Technology: Google Font API, Html, Javascript, jQuery, Lightbox, Php, Pingback, Google Analytics, Wordpress
      Number of Javascript: 10
      Number of meta tags: 5
    10. enbuscadevalentina.es
      Germany - 217.160.230.116
      Server software: Apache
      Technology: Html
      Number of meta tags: 1

    Check Other Websites